ASSAYED, NOT ASSERTEDSee Sample COA->
← Back to catalog

peptide

ACTH 1-39

Corticotropin (ACTH 1-39)

Peptide HormoneEndocrine ResearchPOMC-derived Peptide
ACTH 1-39

Purchase options

ACTH 1-39 purchase details

From $7.64/vial · In stock

Lowest published volume-tier equivalent. View pack prices and order tiers below.

Specifications1 SKUs

5mg*10vials

ACTH-1-39-5MG-10VIALS

≥99%

$142.08Tier 1 / 10 vials

MOQ: 1 10 vials

Order T1$200+$142.08
Order T2$2,000+$106.56
Order T3$5,000+$87.02
Order T4$10,000+$76.37

Worldwide shipping to most destinations. Contact us on WhatsApp for special destinations.

Orders are normally prepared for dispatch the next business day. Contact us on WhatsApp for special handling or timing requirements.

XPeptideSource presents ACTH 1-39 as a peptide for custom blends & oem procurement teams. Identity checks reference CAS 9002-60-2, formula C207H308N56O58S, 4541 Da molecular weight, 39-residue sequence; SKU coverage includes 5mg*10vials, with MOQ and tier pricing reviewed against the purchase-list total. The sourcing file centers on ≥99%, COA/HPLC/MS/SDS readiness, storage notes, and batch context.

Buyer fit

Who buys this, and why

ACTH 1-39 is listed for qualified B2B buyers reviewing B2B research-material procurement. Procurement teams should compare identity, purity, storage, document support, SKU planning, and B2B quote review while keeping the page focused on research-material sourcing rather than personal-use, dosing, treatment, or outcome guidance.

Category: Custom Blends & OEM. Reference fills, custom blends, private-label/OEM materials, diluents, and sourcing support items.

Specifications

Procurement-ready product data

CAS
9002-60-2
Molecular formula
C207H308N56O58S
Molecular weight
4541 Da
Appearance
Lyophilized powder or supplied format listed on batch COA
Purity / identity
≥99%
Common vial sizes
5mg*10vials
Storage
Store according to the batch COA and product handling note.

Batch Quality Verification

See how XPeptideSource verifies a lot before document review.

Sample COA format, lot-code conventions, and the current-batch matching workflow are summarized below. Sample values are clearly marked as demo records; live HPLC/MS and release files are matched by QA.

Sample verification card

PS-ACTH139-2606-076

Public demo page showing the XPeptideSource COA format, QA status, and PDF access pattern.

Current batch request

Matched by SKU + lot ID

Live order documents are supplied after QA confirms the exact product, SKU, and available lot.

Example lot-code format

PS-ACT-2606-461

Format example only. Real batch IDs are assigned from production and release records.

QA review window

4-10 business hours

Typical document-matching window for qualified procurement requests, subject to current batch status.

Laboratory Planning Tool

Plan vial mass, volume, and inventory notes.

Open the calculator as a procurement planning aid for vial mass, diluent-volume records, and target concentration notes. It is not a human-use protocol, administration guide, or clinical recommendation.

Open laboratory calculator

Priority sourcing brief

ACTH 1-39 sourcing matrix for B2B procurement review

ACTH 1-39 sourcing is reviewed as a custom blends & oem procurement record, not as personal-use guidance. Identity fields include CAS 9002-60-2, formula C207H308N56O58S, 4541 Da molecular weight. Buyers can compare SKU sizes such as 5mg*10vials, ≥99%, document readiness, MOQ, lead time, and repeat-supply fit before requesting a quote.

Compare category

Quick sourcing answer

Category fit
ACTH 1-39 is best reviewed as B2B research-material procurement, with buyer-side review focused on identity, purity, storage, document support, SKU planning, and B2B quote review.
Identity fields
Public page fields include 9002-60-2, formula context C207H308N56O58S, and molecular-weight context 4541.0000 Da.
Document support
Qualified buyers can request COA, HPLC purity support, MS identity context, SDS, storage notes, and current batch information tied to the offered SKU.
Research-use scope
This record supports supplier comparison and research-material procurement review only; it does not provide personal-use instructions, dosing, treatment claims, or clinical recommendations.

Procurement checks

  • Confirm product identity, CAS or component context, and available public source anchors.
  • Compare SKU size, MOQ, lead time, order tier, and repeat-order planning before quote approval.
  • Request COA, HPLC, MS, SDS, storage notes, and batch context tied to the offered lot.
  • Keep the review focused on research-material sourcing, not human-use instructions.

Buyer comparison notes

Family-specific review
This row gives the page a category-specific semantic signal rather than a generic peptide-template footprint.
Identity review
Use these fields to orient product matching, then confirm the current batch document packet before quote approval.
Quality packet
The requested files should match the SKU, batch, and commercial offer being reviewed.

Sourcing matrix

ParameterProcurement valueReview note
Family-specific reviewidentity, purity, storage, document support, SKU planning, and B2B quote reviewThis row gives the page a category-specific semantic signal rather than a generic peptide-template footprint.
Identity reviewACTH 1-39; CAS: 9002-60-2; Formula: C207H308N56O58S; Molecular weight: 4541.0000 DaUse these fields to orient product matching, then confirm the current batch document packet before quote approval.
Quality packetCOA, HPLC, MS, SDS, storage notes, and batch context available for qualified procurement review.The requested files should match the SKU, batch, and commercial offer being reviewed.
Commercial fitSKU size, MOQ, tier price, lead time, destination requirements, and repeat-order expectations.This separates sample evaluation from distributor replenishment, OEM, or bulk procurement planning.

Request checklist

  • Current SKU size and fill target
  • COA, HPLC, MS, and SDS document needs
  • MOQ, order tier, and repeat-order estimate
  • Storage, transport, and destination-market requirements

Quality documentation

COA, HPLC, and MS support for this product.

Batch document coverage is summarized below. Qualified buyer packets are matched by product name, SKU, purchase-list item, and confirmed lot during QA review.

COA

Batch-specific certificate available for qualified buyer review.

HPLC

Purity documentation available for every product.

MS

Molecular identity confirmation available on request.

SDS

Safety and handling documents available for procurement review.

Document packet

Document coverage for qualified buyer review

COA

Batch-specific certificate of analysis for buyer review.

HPLC chromatogram

Purity chromatogram available for every product request.

Mass-spec identity

Identity support packet can be matched to the requested SKU.

Residual solvent / counter-ion

Provided when available or required for procurement review.

SDS / MSDS

Safety and handling document available for operational review.

Stability or release support

Shared when relevant to the requested batch or OEM workflow.

Molecular & Structure

CAS
9002-60-2
Molecular formula
C207H308N56O58S
Molecular weight
4541
Sequence length
39
Amino acid sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Research Evidence & Regulatory Notes

PeptideSource keeps public identity references and supplier-side documents attached to ACTH 1-39 as sourcing support. Qualified buyers can request the current COA, HPLC chromatogram, MS identity support, SDS, storage guidance, and applicable batch context before quote approval.

Public identity data do not establish the purity, salt form or terminal state of a specific commercial SKU.

CAS registries may list multiple identifiers for corticotropin preparations.

Public Sources & References

UniProtuniprot.orgEurope PMCeuropepmc.org · 15 recordsPubChempubchem.ncbi.nlm.nih.govImproving sensitivity and selectivity of human ACTH[1-39] quantitation using online size exclusion chromatography and antibody-free LC-HRMS.Jones BR, Shan L, Spytko A, Luo R, Ayala A, Wang J, Lowes S. · 2025 · Initial public research importCorticotropin releasing hormone-expressing inputs to the thalamic paraventricular nucleus: pathways from mother to memory?Mendoza JM, Floriou-Servou A, Chen Y, Kooiker C, Hardy M, Baram TZ. · 2026 · Europe PMCA hybrid IA-LC-MS/MS method for adrenocorticotropic hormone(1-24) to support interpretation of low-dose cosyntropin-stimulation test.Jones BR, Shao J, Sanghvi M, Ayala A, Luo R, Wang J. · 2024 · Initial public research importWhat's in a name? Nomenclature inconsistencies in the corticotropin-releasing factor/hormone system across time and taxa.Culbert BM, Bernier NJ. · 2026 · Europe PMCIngested (Oral) Adrenocorticotropic Hormone Inhibits IL-17 in the Central Nervous System in the Mouse Model of Multiple Sclerosis and Experimental Autoimmune Encephalomyelitis.Dittel LJ, Dittel BN, Brod SA. · 2022 · Initial public research importHormone-Tuned Fear Circuits: Estrous Regulation of Corticotropin-Releasing Factor Neurons in the Bed Nucleus of the Stria Terminalis.Marin-Blasco I, Andero R. · 2026 · Europe PMCMelanocortin receptor agonist ACTH 1-39 protects rat forebrain neurons from apoptotic, excitotoxic and inflammation-related damage.Lisak RP, Nedelkoska L, Bealmear B, Benjamins JA. · 2015 · Initial public research importModulation of Corticotropin-Releasing Hormone Receptor Expression During In Vitro Keratinocyte Differentiation.Martins CA, Lesink S, Roux A, Collet G, Daniellou R. · 2026 · Europe PMCThe melanocortin ACTH 1-39 promotes protection of oligodendrocytes by astroglia.Lisak RP, Nedelkoska L, Benjamins JA. · 2016 · Initial public research importThe acid-sensing ion channel 1a modulates anxiety- and depression-related behaviors via its influencing on the activity of corticotropin-releasing hormone-expressing neurons in the hypothalamic paraventricular nucleus in male mice.Yue J, Zhang Q, Wang M, Yao X, Wang M, Liu L, Huang Z, Xing Y, Yan J, Yan Z, Song XL, Wang W. · 2026 · Europe PMC

Buyer questions

Common sourcing questions

What does the published $7.64/vial price mean for ACTH 1-39?

The published lowest equivalent is $7.64 per vial, calculated from a $76.37 per 10-vial pack at Tier 4 for an order total of $10,000 or more. It is a published volume-tier equivalent, not the entry pack price for every order.

What is the published minimum order for ACTH 1-39?

The published minimum order is 1 pack (10 vials) for the referenced pack format. Available SKU options and order-wide price tiers are shown in the purchase section.

Is ACTH 1-39 currently listed as in stock, and when is it prepared for dispatch?

Active published SKUs are listed as in stock. Orders are normally prepared for dispatch the next business day; special handling, timing, and final destination acceptance need confirmation before approval.

How can a buyer check that ACTH 1-39 documents match the offered batch?

Request the COA, HPLC chromatogram, MS identity support, SDS, and lot context for the exact SKU and batch. A sample file demonstrates the document format; it does not prove the availability or paperwork for a future order.

Which destinations can be supplied for ACTH 1-39?

XPeptideSource supports shipping to most destinations. Buyers with a special destination should confirm destination requirements and the available shipment plan before order approval.

What makes ACTH 1-39 different from a generic peptide listing?

ACTH 1-39 is grouped for B2B research-material procurement, so the useful procurement review includes identity, purity, storage, document support, SKU planning, and B2B quote review in addition to identity fields, SKU size, MOQ, and quote terms.

Which quality documents can be requested for ACTH 1-39?

Qualified buyers can request COA, HPLC purity support, MS identity context, SDS, storage notes, and batch-specific information when available for the quoted SKU.

How should buyers compare ACTH 1-39 before approving a quote?

Compare identity fields, category-specific review points, purity basis, SKU size, MOQ, lead time, tier pricing, storage expectations, and document packet readiness.

Does this page provide use instructions for ACTH 1-39?

No. The page is written for qualified B2B research-material sourcing, supplier evaluation, and document review only.

Can XPeptideSource support bulk or repeat-order review for ACTH 1-39?

Yes. Buyers can share target SKU sizes, quantity expectations, document requirements, destination needs, and repeat-order plans for B2B quote review.

Which identity fields define ACTH 1-39 for XPeptideSource sourcing review?

ACTH 1-39 is reviewed against CAS 9002-60-2, formula C207H308N56O58S, 4541 Da, 39 residues, sequence support. The next check is the current batch packet, including COA, HPLC chromatogram, MS or identity support, and any label or storage notes needed for a procurement file.

How should ACTH 1-39 searches around vs shorter acth fragments sourcing compare be used for sourcing?

vs shorter ACTH fragments sourcing compare is treated as search context, not as a protocol or outcome claim. XPeptideSource people usually check CAS 9002-60-2, formula C207H308N56O58S, 4541 Da, SKU coverage such as 5mg*10vials, purity basis, COA/HPLC/MS support, storage notes, and batch-document availability before comparing suppliers.

How does XPeptideSource handle COA, HPLC, and MS requests for ACTH 1-39?

Send the product name, SKU, or intended purchase-list line and the support team will match available COA, HPLC chromatogram, MS identity support, SDS, storage notes, and related batch context. Documents are shared for qualified buyer, sourcing, and procurement review.

How should ACTH 1-39 SKU size and fill options be scoped?

ACTH 1-39 has catalog coverage that includes 5mg*10vials. Buyers should compare the full SKU ladder, minimum order, sales unit, and order-wide tier pricing before deciding whether catalog supply, bulk replenishment, or custom fill review is needed.

Can ACTH 1-39 move into a custom, blend, or OEM sourcing workflow?

That depends on material type, vial size, minimum order, document requirements, packaging needs, and current batch availability. Send the target SKU, quantity, label needs, destination market, and document requirements so feasibility can be reviewed.

What storage or stability evidence should accompany ACTH 1-39?

ACTH 1-39 storage should be checked against the batch COA, product label, and logistics notes. When stability or handling details matter for a buyer's workflow, XPeptideSource can share available support documents by request.

Research Center

Procurement comparison and document guides

View all guides

Related products

More in Custom Blends & OEM

Browse category
Contact XPeptideSource on WhatsApp